SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000198 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000198
Domain Number 1 Region: 262-431
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.61e-24
Family Protein kinases, catalytic subunit 0.0017
Further Details:      
 
Domain Number 2 Region: 3-51
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000466
Family Ankyrin repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000198   Gene: ENSDORG00000000214   Transcript: ENSDORT00000000216
Sequence length 1405
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2269:4260:66866:-1 gene:ENSDORG00000000214 transcript:ENSDORT00000000216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCFDGSTPVHAAAFSGNQWILSKLLDAGGDLRLHDEKGRNPQTWALSAGKDRSTPMVEFM
QRCTSHMQAIIQGFSYDFLKKIDSSQRLICSPPWFGGLIQGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLI
WNGSRVTVKELNLTHSHCSRLRLADLLIAEQEHSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRSQFPLLHMEVIVHLLLQIAEALRYLHSWGFVHRSLSSYAVHIV
STGEARLTNLEYMMERQDNGVYRDLTRIPLPTQLYNWAAPEVILQKAATIKSDIYSYSMI
IQEILTDNIPWDGLDGLAIKEAIVLGNYLKADVRLPKPYYDIVKSGIQVKQKDRTLNLQD
IRYILKNDLKEFIGAQRTPPTKSPRIQRYEPQPNVNEYLGLISEHRKETPVFEIKELKET
GRQSHSPREYSCSIDKTLAPQSPDPSSTAQEPPPPPPPPLVPQEARSLNAGQASLCSFEI
NEIYSCVNLGVYREQTPRMASSLEEDRPNQPDELQSLEEELXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXNLSVQSTYSAESSEDITDEFLTPDHEYFYSAAQENLSVQTSSPIED
DFEGIQGAFSQPQGYGEEKMQIKKILEKNSEIFTGGQFQPSQXXXXXXXXXXXXXXXXXX
XXXXSLIDIQDLSSISYEPDGSFKEASCKTPKLSHAPTCVSTPVSPXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAISQHHIDELPPPSQELLDEIEQLKQQQAS
ATVSHANTACDPRVIENDQKRSEEQEADNNKEDSLLWTKENQDLGEDTERAHSTLDEELE
RWLQLPEESMVIQDQKDSTRETKKKDQEVGESKRRWKENINPERRKSESFLGTSEEDELK
PCFWKRLGWSEPSRIIVLDQSDLSD
Download sequence
Identical sequences ENSDORP00000000198 ENSDORP00000000198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]