SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000309 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000309
Domain Number 1 Region: 631-993
Classification Level Classification E-value
Superfamily ARM repeat 4.61e-52
Family Armadillo repeat 0.0095
Further Details:      
 
Domain Number 2 Region: 437-624
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.19e-29
Family Ankyrin repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 1032-1112,1155-1235
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000429
Family Plakophilin 1 helical region 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000309   Gene: ENSDORG00000000331   Transcript: ENSDORT00000000331
Sequence length 1363
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3212:17573:66385:1 gene:ENSDORG00000000331 transcript:ENSDORT00000000331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQMNTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLVDITKDPDFSGIYDEDMNEDPTYDPNSPEEKAVFMKYAEHIMLKMTFST
TQVQQHENVFIFETAYWLTNAIKYTQDYLDICTYQRLQQRLYLQKKVIQKHFEKKKEIRR
GIGYLKLICFLIPFLLSLKRKMKVPYLNSLLQPFSDDKVKTERELPPFVYGKDFKCQNFH
YKENQYFHVHGGIEFDISTPPIENALEDFKNNIQKIQDCATKTFAEDSGYKEHYSIPVME
LNGKSYYVICFDLEIFYQQLYKTQWWGAINEIVNTLRVKRLPLTEAQLHEQFKKKFGFKK
SMKCKSIPFGMKSAVERGLSAVFHTFGRKTSSSSINVSDEAGYTIFHHAALHNRVSVICQ
LCNANFNVNQRRFIMFSQGPTPLHLAAQACSLEATICLLCFKADYTLSEKRGWMPIHFAA
FYDNICILIALCRKEPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSLGANWRKTDTK
GNNIIHLSVLTFHTEILKYIIELDIPELPVWKTLVEMLQCENFKRRMMAVMSLEVICLAK
DEYWKCILDAGTIPALVNLLKSNRIKLLCKTVGLLSNISTHESIVHALVEAGGIQALIKL
LAIDEPELHSRCAVILYDIAHYENKDVIAEYNGIPALINLLDLDIENVLINVMNCIRVLC
MGNEKNQKAMIEHKGIQHLIRFLSSDSDVLKAVSSATIAEVGRNNAKVQDALATQGAIPP
LVALFKGKQLSVQVKGAMAVESLANHNYLIQKEFLERNLTKYLLKLLKAFQIDVKEQGAI
ALWALAGQTLKQQKYMAEQIGYNFIINMLLSSSAKMQYVGGEAVIALSKDSRLHQNQICE
GNGIAPLVRLLRISKIAEGTLLSVIRAVGSICLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXVEVAFSLACIVLGNASLQNELQQSEGFKYSDVLDLLHSSDKDICLRAGYAL
TLFAFNNRFQQYLILESGMMTISIFEPFLQSKVETEKAMAAFQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNLIASLAHSRAGIPEAFTTMGTVQRLCYHLYSGREEV
RTACSCALGYLTYNANAFRILLKECRNKPNQFLRLTNNISRDAKINPAFLKEFQMQEMVG
LPSLSLEKNGGPSIIPVFKKGKEHRRKAKPKIQPKDSLTLIPPVTNFMGLFRKTKKTIVS
HNIFSFSSGMSSDIINVSRPRIVVLSRLGQHEHGSYPEPTEGQ
Download sequence
Identical sequences ENSDORP00000000309 ENSDORP00000000309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]