SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000316 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000316
Domain Number 1 Region: 457-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 289-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-16
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 3 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000895
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000072
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000542
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000294
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000316   Gene: ENSDORG00000000338   Transcript: ENSDORT00000000338
Sequence length 742
Comment pep:novel scaffold:dipOrd1:scaffold_4842:14542:34433:-1 gene:ENSDORG00000000338 transcript:ENSDORT00000000338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKALKLVKDEDFSLGAEGAPPFPHSLQPALSRGKAPPQHPFPEALRGPFSQFRYELPAA
GDLDEFPGVFEGSGSRKRKSMPTKMPSAQPAEEATLALPPEGAQSHGPPSLPMLFPRASH
PKRDSQMIDLCHVGFQFCRTLEHLGGKAIKQEPLKPSAVWAQPAPPAFLPTPYPYYPKMP
AGLVFPLLVPAASPFPFGRHAFLPKPAPAPPLPRKAEPREGEEAAPRAQRVDVNVQIDDS
YLVDVGGPQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACARCGKLFKQLSHLHTHML
THQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAKHAG
GRENICVECGLDFPTLAQLKRHLTTHRGPIQYHCSECDKTFQYPSQLQNHMMKHKDIRPY
ICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCHL
CYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPSK
FTLKGNLTRHMKVKHGVMERGLHSQGLGRGRISLAQTAGILRDLEQEEPFDLSQKPGVKR
PLFNSDEESAQGSPCHEVEEDDDGDNCCEVEPISPGVPPENQQLCAPQDLSTKPEQGLQG
LGEACKEEEDGPKEQEERNKDLEGTEGSQERDCAHKDERLAFFQSTRRGPSFSDYLYFKH
RDESFKELLERKMEKQAVLLGI
Download sequence
Identical sequences ENSDORP00000000316 ENSDORP00000000316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]