SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000374 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000374
Domain Number 1 Region: 17-58
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000000000000343
Family SCAN domain 0.00099
Further Details:      
 
Domain Number 2 Region: 235-286
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000118
Family KRAB domain (Kruppel-associated box) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000374   Gene: ENSDORG00000000396   Transcript: ENSDORT00000000397
Sequence length 312
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4544:757:7366:-1 gene:ENSDORG00000000396 transcript:ENSDORT00000000397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPPGENPTPQGELPSPESSRRLFRRFRYQEAAGPREALHRLWDLCRGWLRMERHTKXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHCEDPVVI
DDGDGPPDQEQERLPVEPQSDLTKSQDAQPAALAQGLGFLSRPPGQLCEDPVPQDVVLQE
ESMRDAQQVTTCHLPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRVSPFKD
MILCFSEEDWSLLDPAQTGYYGEFIIGEDYEVSVSPNEAPAQPDLSQGEESEPRVPEFQD
LQGKEGPQVPHL
Download sequence
Identical sequences ENSDORP00000000374 ENSDORP00000000374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]