SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000449 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000449
Domain Number 1 Region: 111-183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.53e-17
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 2 Region: 234-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.56e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 172-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000138
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 4 Region: 426-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000126
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 481-539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 49-115
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000283
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 7 Region: 299-358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000472
Family Complement control module/SCR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000449   Gene: ENSDORG00000000479   Transcript: ENSDORT00000000479
Sequence length 596
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5879:94336:113525:1 gene:ENSDORG00000000479 transcript:ENSDORT00000000479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPSRAGNGTYHGKREMAVWVLPKLSSVSDPSLFRITLAATLLATVLGNCGPPPYLDFAL
PVKEIDQEDFNIGTILKYTCRLGYSKTSSNLNLVCSKDNTWKYGEFCVKKRCQNPGDLPN
GQIEIKTDFSFGSQIHFSCSEGYMLTGPATSFCEIQDRGVGWSDPLPVCVSVVCESPPVI
SNGKHNGGDEDVFTYGSSVTYSCDPNFSLIGNASISCSVVNKTIGIWRPDPPTCKKISCP
QPDVPHGKIVSGFAPVYSYKRSIVFTCQKGFILRGNSIIHCQADGKWNPSPPICTPNSCL
GLPDIPRASWIEYYKLREDNIYQPGTRLTYRCNFGYKPAGNEPMTVVCQRNFKWTPFNGC
KKICCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXCQFPPKIAHGVYKLSHGFYSATEATYTCEEGYSLIGAATLTCGNWQWLPAAPECK
AQCQKPQIENGKVSVNKAQYVEPENITIHCDSGFSVVGPQSISCSENGTWYPRVPRCEWD
VPEGCEQVLEGRKLMQCLPSAEEVKMALEIYKLSLEIELLELQRDKARQPVLEPSP
Download sequence
Identical sequences ENSDORP00000000449 ENSDORP00000000449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]