SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000455 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000455
Domain Number 1 Region: 143-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000133
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000455   Gene: ENSDORG00000000484   Transcript: ENSDORT00000000486
Sequence length 1597
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2398:5735:68205:1 gene:ENSDORG00000000484 transcript:ENSDORT00000000486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPEPSCPGPSAKDKPIPVVGLPGASSGQASPRLTLGPVILPQEQGLHSAVFLKALPIP
LYHTVPPGGLQPRAPLVTGSVDAGGVPFILSPLLQPEGPGPSQGGKLGAPTLTVNIVGAL
PVLSPGLGPTLGSPGKAKNAGKYLCPHCSRDCLKPSVLEKHIRSHTGERPFPCATCGIAF
KTQSNLYKHRRTQTHLNNSRLSLESEAGRSSLGEEESRVREPPIAESGSQGAERALSPGL
HLSPAAQSLEMKTEAAPCPGATPAHREAPADHTQMASPGLPLASPQPRRKILEPKPCSLP
RQQETTSEKPWDTKASEGRLSKCESTDSGYLSRSDSAEQPPVTSSPLHSLSEHSVESEGE
GGPGPGLGAVEAEAGAPGPSLELERKQLEERIARLISHNQAVVDDPQLDHVRPRKTVLSK
QGSIDLPMPYTYKDSFHFDIRALEPGRRRAVHSPAPSTFPPLDKSRPLFFHSVPTQLSTA
VECVPVTRSNSLPFVEGSRTWPEPRDLGDIFPRMQKPPSPRLPPARLGCRSRMTLADVPS
GHPRALVRQAAVEEMLCVSGGDTSAPAEDLDVVCKGHVASRKGRPRKGQMFSQEKWQVYG
HETFERIYQKTKSSHQGGQKSREVRGEPGTEPHLAPQEEAAGADSAAPAQVPSTSVHTAA
SAEARWGAGGNLPTPENSSEAQPAPQGKAAAGARGSNPPRQATTASPSPLGSGVPPSLGT
RSALLPPDGRPEPLPGEGPRTSGPAVPDAKRQAGSRGEAVKISPWAQAAPRRLSGSAGEP
PSAEDKLPSERKKLRVDGTGLQEQLGPPGVDTPGGPVRVASLPSQMQGSDPQGGSERSRE
GTKCPADPLTRDRQGPGEEPTPRPAPRVSGPHLQLAPPRDSRGPSALTHSTFPPKYLLRL
PQGETHPPPPIPPLPGQHPDSPCSSGQLKGQASAVGSVPGSAQPPDPALGPTPGEAEGLL
EDPSRPRPRDRGEEAQAGSEKGDRVRAKVPDTRDSPSLAPGLPWEPAPFPPTPTGHGPLA
RDRHHLSQDSTSAEAQGPGGLLNSWVPPQEPVQPHKNAPEDSVPEPLAELRPCCPSQSSS
SRTALTRPQGWAPSLPEPCLARAQSPFPSLRAEPRLTWCCLSRSLPLPAEQKERAESVYS
SWYCPGSHLQAEGPGPPTGTRGWIRTSPGAGKPAPQTPELCYPAVQGMRCRGLVSDPERK
KGPWRRRVKASRGSSKQKKPRLHPKRCEGSFWQSHTQLRASRLHKLPWGPRGRCLPPLLK
GQEPRGPLRRASSEMAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDTSLSTGEHGDCSHLDVADASGLSVQPPTGSTLGKAEALLQDKGLDFVLL
PSQDHDAIDPRPCISSDAQASSSSECKGTAPYQAIATSVAAACIPLGVQGTDVQAHHQAV
EEAQPQSSPDGRVAAEATALTSLTETPLSGQKAVGLALLGSPRKTHLEIPASGPSSASSP
QEEGRHQTAFPSSAQYRGGDTAIPCPALGLGSGKCQPPGLISLRGSEASPSLGQPSEFPE
APSRSVRKRSLEGMRKQTRVELSDTSSDDEGRLVIEI
Download sequence
Identical sequences ENSDORP00000000455 ENSDORP00000000455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]