SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000485 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000485
Domain Number 1 Region: 7-141
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.93e-36
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 190-285,325-449
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.34e-32
Family Protein kinases, catalytic subunit 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000485   Gene: ENSDORG00000000519   Transcript: ENSDORT00000000519
Sequence length 452
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4949:148:6208:1 gene:ENSDORG00000000519 transcript:ENSDORT00000000519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPMDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLAKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIISHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHESTXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXIDEDMTARITLADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Download sequence
Identical sequences ENSDORP00000000485 ENSDORP00000000485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]