SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000524 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000524
Domain Number 1 Region: 37-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-59
Family Ankyrin repeat 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000524   Gene: ENSDORG00000000563   Transcript: ENSDORT00000000562
Sequence length 361
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1561:214101:223523:-1 gene:ENSDORG00000000563 transcript:ENSDORT00000000562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPGDPRRLCRLVQEGRLRALQEELRAAGGCQGPAGDTLLHCASRHGRLDILAYLAETC
GMDIEAANRDYKRPLHEAASMGHRNCVGYLLDRGAAVDCLKKGDWTPLMMACTRKNLEVI
QALVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPDAWKTESKIRRTPLHTAAM
HGCLEAVKVLLKRCQYEPDCRDNCGVTPFMDAIQCGHVEVARLLLEKHQACSSAEDSLGA
QALHRAAVTGQDEAIRFLVSDLGIDVDVRATTTHHTALHYAAKEGHTSTLETLLSLGADI
NAKDERNRSALHLACAGQHLACAQFLLRSGLKDSEDITGTLALQLTQNVDILQGFDPCAT
T
Download sequence
Identical sequences A0A1S3EMS7
ENSDORP00000000524 XP_012864782.1.60039 ENSDORP00000000524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]