SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000540 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000540
Domain Number 1 Region: 390-474
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000597
Family SWIRM domain 0.003
Further Details:      
 
Domain Number 2 Region: 195-240
Classification Level Classification E-value
Superfamily BRCT domain 0.000000349
Family BRCT domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000540   Gene: ENSDORG00000000578   Transcript: ENSDORT00000000580
Sequence length 1038
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5453:6578:67922:-1 gene:ENSDORG00000000578 transcript:ENSDORT00000000580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGTLCHILGAA
YKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLARPNIYLIPDIDLKLANKLK
DIIKRHQXXXXXXXXXXXXXXXXXXXXXXXXEWLRPVMRKDKQVLVHWGFYPDSYDTWVH
SSDVDAEIEEPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRISTKNE
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQANLYGKRRSQKEEDEQE
DLTKDMEDPTPVPNIEEVVLPKNVNPKKDSENTPVKGGTVADLDEQDEEAITTGGKEDED
PSKGDQSRSVDSSEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHAFLEQWGLVNYQVDPESRP
MAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPIDLQNFGLRTDI
YSKKTLAKSKGASAGREWTEQETLLLLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLEQQRQQLLTERQNFHMEQLKYAELRARXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIPGPGSMMP
GQPMPGRMIPTVAANIHPAGTGPAPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQQPPPP
ADGVPPPPAPGPPASVTP
Download sequence
Identical sequences ENSDORP00000000540 ENSDORP00000000540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]