SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000641 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000641
Domain Number 1 Region: 40-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.07e-31
Family SCAN domain 0.00013
Further Details:      
 
Domain Number 2 Region: 243-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.11e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 270-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000185
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000641   Gene: ENSDORG00000000688   Transcript: ENSDORT00000000687
Sequence length 329
Comment pep:novel scaffold:dipOrd1:scaffold_14166:9604:15415:1 gene:ENSDORG00000000688 transcript:ENSDORT00000000687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKGVSSTHLPQTPEEPDEVIAVKMEEEEQGSSLHNSCYSPDTFRQHFRHFHYQNSPGP
REALSQLGELCCCCWLRPELYSKEHILELQVLEQFLAILPEELQIWVQKHHPENGEEVVI
LLEQVEREAHGLAGQVFFGLRKAAAVDELVPWEITPKLPSSQRKPLKQPQRPSWELPPLR
QHDEDTKTINEKSASRKKTFSGVDLHCDVSSTFPMNASPSFTSTGTWEQDGRFERRQGNP
SRRKQHKCDECGKIFSQSSSLILHQRIHSGEKPYACDQWAKAFSQSAILIQHRTHTGEKP
FKCHEGKAFSQSSNLFRHRKRHRREKVPS
Download sequence
Identical sequences ENSDORP00000000641 ENSDORP00000000641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]