SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000660 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000660
Domain Number 1 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.17e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 27-87
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.64e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 461-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000660   Gene: ENSDORG00000000706   Transcript: ENSDORT00000000707
Sequence length 548
Comment pep:novel scaffold:dipOrd1:scaffold_41267:4272:9161:-1 gene:ENSDORG00000000706 transcript:ENSDORT00000000707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDFRHWDCHFAAGIRLYSWRHEGLGAFQERLMTFEDVAVYFSWEEWLLLDATQKALYRHV
MLENFALVTSLGLSASRPRVVVLIQRGEEPWVLSEMDTGLAGSTDERHILGARSLVEDKP
SGLQAFLQTASGTGNGSAARASPPPGRRPAGVSVIYWERLLPGAGHEEGVGLRLTSPQKP
PEGGPTRPKVLAGGRARGRRPRRTRRPRLGGLGSEGAFQPVPVPVPALGDRGPGLGGTGQ
EARRRCGPGPGSWTGDGLGWAPRAGEKPFECRACSKVFVKSSDLLKHLRTHTGERPYACA
QCGKAFSQTSHLTQHQRIHSGETPYACAACGKAFRHSSSLVRHQRIHTAEKAFRCGDCGK
AFSHGSNLSQHRKIHAGGRPYACARCGRRFCRNSHLIQHERTHTGEKPYACALCGAAFSQ
GSSLFKHQRVHTGEKPFACAQCGRAFSHSSNLTQHQLLHSGERPFRCADCGKAFAKGAVL
LSHQRIHTGEKPFACAQCGRAFRERPALFHHQRIHSGEKRAPAPARALRPRPRLARVRLR
EAPQPAEA
Download sequence
Identical sequences ENSDORP00000000660 ENSDORP00000000660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]