SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000663 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000663
Domain Number 1 Region: 180-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000211
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 213-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000562
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000663   Gene: ENSDORG00000000712   Transcript: ENSDORT00000000711
Sequence length 249
Comment pep:novel scaffold:dipOrd1:scaffold_24713:2808:6075:1 gene:ENSDORG00000000712 transcript:ENSDORT00000000711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELTISSSPPEDTLISPS
FSYNLETNSLNSDVSSESSDSSEELSPTTKFTSDPIGEVLVNSGNLSSSVTSTPPSSPEL
SGEPSQVWSCVSGELSSPGKVRSGTLGKPGDKGSGDASPDSRRRVHRCHFNGCRKVYTKS
SHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDH
LALHMKRHL
Download sequence
Identical sequences ENSDORP00000000663 ENSDORP00000000663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]