SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000720 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000720
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 20-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-25
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 3 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 10 Region: 210-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 11 Region: 682-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-17
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000720   Gene: ENSDORG00000000770   Transcript: ENSDORT00000000769
Sequence length 741
Comment pep:novel scaffold:dipOrd1:scaffold_6752:19750:30789:-1 gene:ENSDORG00000000770 transcript:ENSDORT00000000769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLSSACLSEGHTLLPSANFQESVTFKDVIVDFTQEEWKHLDPTQRDLFRDVALENYTH
LVSVGLQVSKPDVISQLEQGTEPWIVEPSIPGGAFGEWNTNCVDISTKVLPVESTVEKHK
KYGSGSSSVLETWESEGSLERQQANQPISPREIKVTKKAIPTWERSHVNSEFAKSGSVNS
SLRTQQEISLEQISTKKSVKQKSHPIKKEKSCKCNECGKAFSYCSALIRHQRTHTGEKPY
KCNECTKAFSRSENLINHQRMHTGDKPYKCDQCGKGFIEGPSLVQHQRIHTGEKPFKCDE
CGKAFSQKTHLVQHQRIHTGERPYTCNDCGKAFSQRGHFMEHQKIHTGEKPFKCDECDKT
FTRSTHLTQHQKIHTGEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECNECGKAFSQH
SNLTQHQKTHTGEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCNECGKAFSYCSSLT
QHRRIHTREKPFECSECGKAFSYLSNLNQHQKTHSQEKAYECKECGKAFIRSSSLAKHER
IHTGEKPYQCDECGKTFSYGSSLIQHRKIHTGERPYKCNECGRAFNQNIHLTQHKRIHTG
VKPYECSKCGKAFRHCSSLAQHQKTHTEERPYQCNKCEKTYSQSSHLTQHQRIHTGEKPY
KCNECDKSFSRSNHLTEHQNTHTGEKPYNCNECTKTFSQSTYLIKHQRIHSEKKPFGCSS
CGKSFRYRSALNKHQRLHPDM
Download sequence
Identical sequences ENSDORP00000000720 ENSDORP00000000720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]