SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000742 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000742
Domain Number 1 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000159
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 211-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000575
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000742   Gene: ENSDORG00000000798   Transcript: ENSDORT00000000793
Sequence length 266
Comment pep:novel scaffold:dipOrd1:scaffold_1023:73378:74903:-1 gene:ENSDORG00000000798 transcript:ENSDORT00000000793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP
AMHLPRSSFSKVPGAVSSLVDARFQLPAFPWFPHVIQPKPEITTGGSGPVLKTKPRFDFA
NLALAATQEDPSKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFC
GRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGF
CQSRTLAVHKTLHSQVKELKSSKIKC
Download sequence
Identical sequences A0A1S3EXE3
ENSDORP00000000742 ENSDORP00000000742 XP_012869081.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]