SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000782 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000782
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.27e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000782   Gene: ENSDORG00000000836   Transcript: ENSDORT00000000834
Sequence length 475
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1477:161:24410:1 gene:ENSDORG00000000836 transcript:ENSDORT00000000834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEACRKIWLGLFDARTS
LIPDSRDPQKIKEFLQEKYEKKRWYVPPDQVKGATCTKGGAPTSVQGSIPGGKPLRTLLG
DPVPPLSDVASTSSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXQTPSHGGFANFDAFGSSPSSSAFGSLPPAGQAPFQAQPTPAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFGVTGQLPSLQSATAVGNTGLAFGAF
TNPFTAPTAAQPQLPSTNPFQPNGLAPGPDFGMSTAGPGFPQPVPPAGAFASPFPPPLYP
AQTSLTHKNGSSFVDLGSSKLGQRPLSQPAGISTNPFMTGSSPFTSKPPTTNPFL
Download sequence
Identical sequences ENSDORP00000000782 ENSDORP00000000782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]