SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000816 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000816
Domain Number 1 Region: 279-327
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000132
Family Forkhead DNA-binding domain 0.00053
Further Details:      
 
Domain Number 2 Region: 385-426
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000222
Family Forkhead DNA-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000816
Domain Number - Region: 141-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000313
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000816   Gene: ENSDORG00000000868   Transcript: ENSDORT00000000868
Sequence length 434
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1233:77665:84601:-1 gene:ENSDORG00000000868 transcript:ENSDORT00000000868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSSCWKAAPKTSDHLGARGPGGILQGWNLRDGAHASSSLNPLPPSQLQLSTVDAHTRTPV
LQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINVASLEWVSREPALLCTFPSPGAS
RKDSTLSGTPSGPCPLLANGVCKWPGCEKIFKEQEDFLKHCQADHLLDEKGRAQCLLQKE
VVQSLEQQLELEKKKLGAMQAHLAGKMALTKTPVVEPLDKGSCCIVASGTQSSTVPAWSG
PRDASDSLFAVRRHLWGSHGNSTFPEFFHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQ
RTLNEIYRWFTRMFAFFRNHPATWKVSASEVLVAGVVSNITTAQSRQTWGWPLRPMGKGK
EVGNGQLLPSVRNDCLLWLVGPLPQNAIRHNLSLHKCFVRVESEKGAVWTVNEFEFRKKR
SQRPSRRSNSTPGP
Download sequence
Identical sequences ENSDORP00000000816 ENSDORP00000000816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]