SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000854 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000854
Domain Number 1 Region: 507-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000813
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000854   Gene: ENSDORG00000000914   Transcript: ENSDORT00000000912
Sequence length 824
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5931:18870:51350:-1 gene:ENSDORG00000000914 transcript:ENSDORT00000000912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNSLSVPPKDQGESNITTGTVQSGKSLQNKSQFRTIAPKIVPRVLTSRVLPCPAPPLSD
QGSLGSPLASKPLAMPTHNYALMQVAGQEGTFSLVALPNVASAQPVQKPRISLPENLKLP
IPRYQPPRNNKGLRKKPSLGSPESGWSRFPVPAQTCPQMCPSPPAHLEFPCKPSPLKQAP
SLDQTPSSMSTAPLTTSGGHRDSRSPVASSQQDWSPPAMPSLATSEELSAIQSLSKISGK
TSFLIKETAKKPPAVASEQLEAQADDTKSMTNLLPTIFSNAVQLVSSVPAGKLPVLPYTK
IKTEVCKSESDTCAADFSLPGHKTDCAQKSSITGDFHKATKKGSKVPVSQMSKQSLCEND
FCPVTKPDLNHKAKMNGGTAKKRGRKRKVADEILAFQGKKRRCRINKCRDGKERAKMDPQ
ESRDQKPGTMRKYRSIMPKPVIVMSALTSLASPTALLPSQTPGSLQQDTLLSSSPTPKYF
TYKQNDSPSPRPSSGLRKGFSGIKKPWHRCHVCNHHFQFKQHLRDHMNTHTNRRPYSCRI
CRKAYVHPGSLSTHMNLHHNENRLKKLVCCEFCAKVFGHIRVYFGHLKEVHRVVISTEAS
TSDPQSGDMPKNRDRDASMRGMEGSLERENKSSLEEDILLNQAEEVKLQIKCGRCQITAQ
SFAEIKFHLLCVHGEEIQGRLQEGILPGSRAAQEALVKHSTPDWKPHPERRKQVKPCAPE
AFPRLKKQLCLHQKDSVETFLDNEVDQPGTSEPQAPDCPSSRTLLLWSDSGFNCLLCAQT
LERKEDLLLHWEHHHNCEDSSRLWAILSAFANQGRIELSHEAGK
Download sequence
Identical sequences A0A1S3F386
ENSDORP00000000854 ENSDORP00000000854 XP_012870235.1.60039 XP_012870236.1.60039 XP_012870237.1.60039 XP_012870238.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]