SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000880 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000880
Domain Number 1 Region: 228-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000809
Family variant C2H2 finger 0.074
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000880
Domain Number - Region: 2-34
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00154
Family Classic zinc finger, C2H2 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000880   Gene: ENSDORG00000000939   Transcript: ENSDORT00000000939
Sequence length 476
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5457:17574:28628:-1 gene:ENSDORG00000000939 transcript:ENSDORT00000000939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXWEDIDSDEDLECEDSEVMDEEEEQDVEEEEE
AGEGPSLGAIPITDCLFCPHHSSSLMKNVAHMTKVHSFFIPDIEYLSDLKGLIKYLGEKV
GVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXARVGHRSLMRYYKQRFGLSRAVAVAKNQAVG
RVLQQYRALWTGSTGAALVRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRAQVRF
Download sequence
Identical sequences ENSDORP00000000880 ENSDORP00000000880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]