SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000886 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000886
Domain Number 1 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.62e-27
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 192-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-21
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 328-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 5 Region: 371-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000886   Gene: ENSDORG00000000945   Transcript: ENSDORT00000000945
Sequence length 440
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4980:920:6505:-1 gene:ENSDORG00000000945 transcript:ENSDORT00000000945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADHVPQEPQALLESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESRTENDEGISEASGSHGMLLGRFQKDI
AQGLKYEEAYGQELSLKRQLGNSTGERLNRKIQEFGQVTAEEKLTPTGERSEKYSEFGSS
LLSQQRLPTGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSSHLIQH
QRIHTGEKPYECQDCGKTFSCSSALILHRRIHTGEKPYECHECGKTFSWSSTLTHHQRIH
TGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQRIHTGEK
PYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNG
MSLSKNSLGVPAELNVAFTR
Download sequence
Identical sequences ENSDORP00000000886 ENSDORP00000000886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]