SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000937 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000937
Domain Number 1 Region: 463-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000703
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 2 Region: 46-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000162
Family C2HC finger 0.064
Further Details:      
 
Domain Number 3 Region: 201-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000939
Family Classic zinc finger, C2H2 0.09
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000937
Domain Number - Region: 595-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000161
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 330-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00849
Family Classic zinc finger, C2H2 0.05
Further Details:      
 
Domain Number - Region: 267-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0355
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000937   Gene: ENSDORG00000000999   Transcript: ENSDORT00000000998
Sequence length 643
Comment pep:novel scaffold:dipOrd1:scaffold_2034:80204:99408:1 gene:ENSDORG00000000999 transcript:ENSDORT00000000998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILEPGDPPLLQQPLQTSKSGIQQIIECFRSGTKQLKHILLKDVDTIFECKLCRSLFRGL
PNLITHKKFYCPPSLQMDDNLPDVNDKQSQAISDLLEAIYPSVDKREYIIKLEPIETNQN
AVFQYISRTDNPTEVIESSDTPEQTEVQVQETNTEQSKVVPVVDTEVETVEPPPVESVTD
EATPTSDEQPQESQADLETSDNSDFGHQLICCLCRKDFNSRRGVRRHIRKVHKKKMEELK
KYIETRKNPNQTSKGRSKNVLVSLSRSCPVCCKSFATKANVRRHFDEVHRGLRRDSITPD
IATKPGQPLFLDSVSPKKSFKTRKQKSPSKAEYNLTACKCLLCKRKYSSQIMLKRHMQIV
HKITLSGTNSKREKGPNNTANSSEIKVKVEPAESVESSPLSITHSPQNELKGTNHSNEKK
NTPAAQKNKVKQDSESPKSTSPSAAGGQQKTRKPKLSAGFDFKQLYCKLCKRQFTSKQNL
TKHIELHTDGNNIYVKFYKCPLCTYETRRKRDVIRHITVVHKKSSRYLGKITASLEIRAI
KKPIDFVLNKVAKRGPSKDETKHSDSKHDGTSNSPSKKYEVADVGIEVKVTKNFSLHRCN
KCGKAFAKKTYLEHHKKTHKANASNSPEGNKTKGRSTRSKALV
Download sequence
Identical sequences ENSDORP00000000937 ENSDORP00000000937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]