SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000987 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000987
Domain Number 1 Region: 620-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 564-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 508-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 676-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.17e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 717-769
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 4-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000693
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 
Domain Number 7 Region: 222-341
Classification Level Classification E-value
Superfamily SET domain 0.00000124
Family Viral histone H3 Lysine 27 Methyltransferase 0.065
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000987
Domain Number - Region: 356-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000706
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000987   Gene: ENSDORG00000001048   Transcript: ENSDORT00000001050
Sequence length 774
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4754:2417:19663:1 gene:ENSDORG00000001048 transcript:ENSDORT00000001050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKDAFKDISMYFSKEEWAEMGEWEKIHYRNMKRNYNMLISIGLKAPRPVFMCHRRQAIKP
QVDDTDDSDEEWTPGRQVKPPWVTFRTEQSRHQKGMPKTPLGNEPSWKKFSGITNFPKTS
RLEQAQRPVSPPGEAGTQGEHCKQKLGPRTKEVKMRMYSLRERKSYAYEEISEPQDDDYL
YCEQCQNFFINSCTVHGPPIFVRDNVVDKGHYDRSVLSLPPGLRIRQSSIPEAGLGVWNE
ESDLPLGLHFGPYEGQITEDEDAANSGYSWMITKGRNCYVYVDGKDKSQANWMRYVNCAR
YDEEQNLVAFQYHRQIFYRTCRVIKAGCELLVWYGDEYGQELGIKWGSKWKRELTAETEH
KLEIHPCNLCSLAFSSQKFLSQHMERSHHSQTFPGTSFIKNFQPWDPCSGDQPQEQQHSY
NQNEKIADQEAKGSSKPTPKKTRHGVTSRASPNPLKGQMERSEETEIMMEEGLRTVQKVN
TDAPSKLSVKTRTSRIVQVKNEKYGQDFSDQSSLTQHQRTHIGEKPHVCRECGWGFTQKS
NLTRHQRTHTGEKPHVCRECGRGFTRKSHLTQHQRTHTGEKPHVCRECGRGFTQKASLTQ
HQRTHTGEKPYVCRECGLGFTWKSCLTRHQRTHTGEKPHVCRECGRGFTQKSSLTQHQRT
HTGEKPYVCRECGRGFTRKLNLTQHQRTHTGEKPHVCRECGLGFTWKSCLTQHQRTHTGE
KPYVCRECGRGFTWKSCLTQHQRTHTGEKPYVCRECGWGFTRKSLLTRHQRTHT
Download sequence
Identical sequences ENSDORP00000000987 ENSDORP00000000987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]