SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001035 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001035
Domain Number 1 Region: 634-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 545-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 672-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000145
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001035   Gene: ENSDORG00000001102   Transcript: ENSDORT00000001101
Sequence length 725
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6327:5687:33953:-1 gene:ENSDORG00000001102 transcript:ENSDORT00000001101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDQRSSPLSFSTVPQEAALCQASAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXYAISKPDLMSQMERGERPAMQEQEDSEEGETPTDP
SAAHDGIVIKIEVQTNDEGSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDLDMQEQEN
ALEESTEGSSEFSELKQMLVEQXXXXXGIVIKTEEQEEEEDEEEEDELPQHLQSLGQLSG
RFEAGMYQTPLPEEMSPDGEDSPPPLQLGNPAVKRLAPPAHGERHHLGESRGSSSQQQRN
RRGERPFTCMECGKSFRLKINLIIHQRNHIKEGPYECSECEVSFRHKQQLTLHQRIHRAR
SGYASPERGPAFTPKHALKPRPKSPSSGSGGGPKPYKCPECDSSFSHKSSLTKHQITHTG
ERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSRPSHLLRHQRTHTGEG
PFKWP
Download sequence
Identical sequences ENSDORP00000001035 ENSDORP00000001035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]