SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001143 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001143
Domain Number 1 Region: 416-528
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 707-772
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000526
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 766-828
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000115
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 594-656
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000017
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 5 Region: 833-893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 357-420
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000607
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 7 Region: 533-597
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000135
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 240-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000759
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001143   Gene: ENSDORG00000001220   Transcript: ENSDORT00000001221
Sequence length 991
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1623:57472:107264:-1 gene:ENSDORG00000001220 transcript:ENSDORT00000001221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLAVLLLLPSLLALPAHGLSPEAPTMGEGQVTGMKETDGELTAAPTPEQPDRGVHFITT
APTLKLLNHHPLLEEFLQEGSERAMEELRPALPFQPDPPTPFTPSPLPRLANQDNRPVFT
SPTPAMAAAPTQPQSREGPWSIESEPSGLHITAPLPPGPSMALPTLHLGERPNTTPPSRT
WTPTQEGPGDMGRPWAPEIMSQTTGLGIEGTIATSTASGDDEETTTTTTTIITTTITTVQ
PPGPCSWNFSGPEGSLDSPTLPNSPSDVGLDCFYYISVYPGYGVEIKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLLRCHF
PQRPAYGDVTVTSLHPGGSARFHCATGYQLKGARHLTCLNATQPFWDFQEPVCIGECPGV
IRNATTGRIVSPGFPGNYSNNLTCHWLLEAPESQRLHLHFEKVSLAEDDDRLIIRNGDNV
EAPPVYDSYEVEYLPIEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKY
GNFSSSAPSYPVGTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITD
SAGVVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDVRVLRIPGDVLTFYDGDDLTQVLGY
SPRSHFKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPRNDTCPELPEIPNGWKSP
SQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLSWSEDLPSCQRVTSCRDPGDVEHSRRL
ISSPKFPVGATVQYICDQGFVLTGSAILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSA
PENGARSPEKRLHPAGATIHFSCAPGYVLKGQASIKCIPGHPSHWSDPPPICRAASLDGF
YSGRSLDVAKAPAASSTLDAAHIAAAIFLPLVAMMLLVGGVYLYFSRLQGKSPLQLPRTH
PRPYNRITVESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences ENSDORP00000001143 ENSDORP00000001143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]