SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001188 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000001188
Domain Number - Region: 323-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000421
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number - Region: 890-916
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00232
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001188   Gene: ENSDORG00000001268   Transcript: ENSDORT00000001269
Sequence length 955
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5192:6435:17968:-1 gene:ENSDORG00000001268 transcript:ENSDORT00000001269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIGCTLNCTCQSFKPGKINNRQCEQCRHGWVAHALSKLRIPAMYPASRVEVVQSSVVFDI
SSLMLYGTQAIPIRLKILLDRLFSVLKQDEVLQILRALDWTLQDYIRGYVLQDASGKVLD
HWSIMTSEEEVATLQQFLRFGETKSIVELMAVQEKEEQSVLAPPSTANIDIRAFIESYSH
RGSRVPTPVDKGNPSSVHPFENLINNVTFMLPFQLFNPLPPALIGSLPEQYMLEQSQDQS
QDPKQGIHAPFSDSSFLTSTPFQVEKEQCLNCPDAITQKEDNAHLSDSSSYSIATKLERT
RLSPEANAKAERSSLSTKKGRVFCTACEKTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMV
FSSLRSRNRHSANPNPRLHMPMNRNNRDKDLRNSLHLAGSENYQRPGFPGIAPDCGPLPS
YPGSGEDSKGQLAFSSIGQNGVLFPNLKTVQPVLPFYLSPATPAELANTPGVLPSLPLLS
SSIPEQLASSEMPLDTLPKKKSRKSSMPIKIEKEVVEVGHKRPLSSDDAPLQVSEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKEAYQDAALTQRASQTSV
IFQGSSRIDRLAYPVSQVHSASLESYPSLHPSEGTILDLSTASGTKSESSSPSSWDSDGL
SEEGPLLTEGSEGTCEGPSLVPGTEGYPICVLMEKADQSLASQPSGLSMTCHLCQKTYSN
KGTFRAHYKTVHLRQLHKCKVPGCNTMFSSVRSRNRHSQNPNLHKSLASSPSHLQ
Download sequence
Identical sequences ENSDORP00000001188 ENSDORP00000001188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]