SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001277 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001277
Domain Number 1 Region: 15-125
Classification Level Classification E-value
Superfamily POZ domain 7.46e-28
Family BTB/POZ domain 0.00063
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001277
Domain Number - Region: 458-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0397
Family Classic zinc finger, C2H2 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001277   Gene: ENSDORG00000001367   Transcript: ENSDORT00000001367
Sequence length 574
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6383:29817:48073:-1 gene:ENSDORG00000001367 transcript:ENSDORT00000001367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNRKEDMEIASHYRHLRELDEQRRHGVLCDACVVVEGKVFRAHKNVLLGSSRYFKTLYC
QVQKTSDQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQAC
HDFIKAALDISIRSDASEELAEFEAGAPASGSTEALISAVMAGRSISPWLARRTSPANSS
GDSAIASCHEGGSSHGKEDQEPKADGPEEVAFPSLWPGDVAYGSLHIKEEQTSPSHYGES
ELPSAKDSAIQNSLSEQGSGRRKNRKNKDTVRHITPRVEADSRPGSPVPSFLPSAGWPFS
SQDSNIDLTVTEGHGVDSQGERTELYAPVDEGLLGGDAGCLGPPLTPEKDEVLRQATAVA
NLRAALMSKNSLLSLKADVLGDDGSLLFEYLPKGAHALSXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHSKDKKYVCKVCSRVFMSAAS
VGIKHGSRRHGVCTDCAGRGVAPPLGRSAGSPAGSPEALFAGRGVYLEDPEDPRGEGEEE
LDEDDGGLAQEDGDSPRGPRSPCTEPGQDFAWAP
Download sequence
Identical sequences ENSDORP00000001277 ENSDORP00000001277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]