SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001278 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001278
Domain Number 1 Region: 11-51,155-188
Classification Level Classification E-value
Superfamily RING/U-box 1.71e-19
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001278
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00623
Family B-box zinc-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001278   Gene: ENSDORG00000001370   Transcript: ENSDORT00000001369
Sequence length 241
Comment pep:novel scaffold:dipOrd1:scaffold_47885:1930:2842:-1 gene:ENSDORG00000001370 transcript:ENSDORT00000001369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDSAPGPVQMLQEEALCAICLDYLSDPVSIGCGHNFCRACVTRLWGEEDEGDSEEEE
VVAEEEEEEEVVGAVGGLDGSLREVFYLGDSREGALQNQAGAGAQVGGGGGDAPGRDLRI
TIYPEEFMDALDYEYEEEYLSSDSDLSSSPPSARKFTCPQCQQTFTRRNLRPNLQLGNMV
QIIRQMCPGDHLVHRGREQEMCSRHQEAMKLFFEAFREPSCTMCRANSNCRGAQVAKAVR
K
Download sequence
Identical sequences ENSDORP00000001278 ENSDORP00000001278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]