SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001286 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001286
Domain Number 1 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 414-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 110-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 148-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001286   Gene: ENSDORG00000001378   Transcript: ENSDORT00000001378
Sequence length 473
Comment pep:novel scaffold:dipOrd1:scaffold_36063:4046:6877:-1 gene:ENSDORG00000001378 transcript:ENSDORT00000001378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCSISKPDVISLLEQGKEPWIVVREERRRWSLDLESRYDTKKLFQEKKFYEMNLSQWEIM
ERIQSHGLGEQEGPPGVYFRQGRKTTTEKIAMDRELGPLHFYQKTPNRAKPYECGDCGKA
FRARQQLTFHQRIHTGEKPYECKECGKTFRQCAHLSRHQRIHTSDKLYECKKCGAIFPCS
SDLRLHQRLHVGEKPYECQECRKAFRVRGQLNLHQRIHTGEKPYKCKECGKTFRQYAHLT
RHQRLNFAERCYECKECGQAFLCSTGLRLHHKLHTGEKPYDCKECGKAFRVRQQLTLHQR
IHTGEKPYDCKECGKTFSRGYHLTLHQRIHTGEKPYECKECQKFFRRYSELISHQGIHIG
EKPYDCKECGKAFRLFSQLTQHQSIHFGEKPYQCKECGKTFRLLSQLTQHQSIHTGEKPY
DCKECGKAFRLHSSLIQHQRIHSGEKPYMCKECKKAFRQHSHLTYHQRIHNVT
Download sequence
Identical sequences ENSDORP00000001286 ENSDORP00000001286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]