SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001314 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001314
Domain Number 1 Region: 579-647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.88e-17
Family Complement control module/SCR domain 0.0074
Further Details:      
 
Domain Number 2 Region: 451-517
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.01e-17
Family Complement control module/SCR domain 0.0053
Further Details:      
 
Domain Number 3 Region: 393-448
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000249
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 332-388
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000262
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 5 Region: 212-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000131
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 272-326
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 90-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000577
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000945
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 9 Region: 38-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000021
Family Complement control module/SCR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001314   Gene: ENSDORG00000001410   Transcript: ENSDORT00000001409
Sequence length 648
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3520:698:30906:-1 gene:ENSDORG00000001410 transcript:ENSDORT00000001409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWEDLVFVIILMISGEICAEEEHCDFPNVENGMLAQYYYTFKNFYFPMRLHKKLSFYCL
AGYTTELGKQKAKTKCTTEGWNPAPRCIRKCSKPELSNGYISDVKVLYKIGDTMRYSCAA
GYKTTGGKHVEEVRCLAHGWSSLPACRKERETCLSPELHNGNYYTTQKTFNVKDKVLYEC
AAGFYTAGGKQAEEVECLPHGWALTPQCTRSTCPTLRLIENGYFYPVKQTYEDGDVVQFF
CHENYYLSGSDLIQCYIGWYPESPFCEGRRNRCPPPPVPLNSKNQSYSQTYRQGEVVRIE
CELNFELQGPAEMHCENGKWTEPPKCVEKKGISCEQPPSIQNGAPIQNSRAYSCGDKVEY
RCETGYQLRGPKEIECHLGQWSSPPECVKQTENCGPPPNITNGAVVGGVLASYTLGSSVE
YRCNEYYLLNGSKTSHCEKGVWSSPPVCMEPCTLSEDDMTKNNIEMKWKTEGKVFHGDLI
EFMCKEGYGLSPSTLPSELSVKCHRGEVKYPFCIRKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCTLSHHEMEKNNLHLKWHFDD
RPFILHGEYVEFHCKRDTFLVESSVIRDEVRVKCDKGYLKYPRCVERE
Download sequence
Identical sequences ENSDORP00000001314 ENSDORP00000001314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]