SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001328 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001328
Domain Number 1 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.53e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 11-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 5 Region: 410-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 224-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000173
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001328   Gene: ENSDORG00000001428   Transcript: ENSDORT00000001425
Sequence length 470
Comment pep:novel scaffold:dipOrd1:scaffold_5398:24753:28600:1 gene:ENSDORG00000001428 transcript:ENSDORT00000001425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPMTMEVPGDPTQACVTFEDVVIYFSQEEWEFLNTTQRLLYLNVMLETFALVTSLGCEYG
IEDEDTSVQSVSLKGMSHLRIPKAGTPSQDTHPCDLFVPVLKDIVRLAELPMQTLYVAGL
PQHLNHRSAEKPWKMDTDQNSLLERDEVCVSGKPRLGLWKDFPLSDLRPQVLPNDEKLNN
EFGEAFHHGKSNCKLVKCRKTSRPLSLSFHHPRVYTGKNLYEHKCEKEFRDDHSLAQHQR
VHTGERPYECRECGKSFKERFSLIAHQRVHTGERPYECRECGKCFRRGCFLTTHRRVHTG
ERPYECRECGKSFRERCSLTKHKRVHTGERPYKCGKCGKSFTQRTHLVSHSTIHTGEKSY
ECGECGKTFRQKSVLIRHQVVHNGERPYECGECGKSFNQRSNLISHWGIHTGEKSYECRE
CGKTFRQKSVLIRHQVVHNGERPYECKQCGKSFKRGYALTVHHHRLLTRQ
Download sequence
Identical sequences ENSDORP00000001328 ENSDORP00000001328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]