SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001335 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001335
Domain Number 1 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 306-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 2-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-17
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 375-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000012
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 229-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000216
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 273-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000535
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 466-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000123
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 188-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000236
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001335
Domain Number - Region: 145-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0716
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001335   Gene: ENSDORG00000001432   Transcript: ENSDORT00000001432
Sequence length 511
Comment pep:novel scaffold:dipOrd1:scaffold_5398:43361:47628:1 gene:ENSDORG00000001432 transcript:ENSDORT00000001432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSVSFEDVTMSFSWEEWNLLDEAQRHLYFSVMLENLARMSSLGRSLEVKHDGTPSEPSIS
VALSQSGTCSPGSALQNECSSEVHGLVLRGIFHSAQHHGTHSRKKPYTYKAQPYLTAGLQ
HHQQHVRELPFGSCVDDSCTIRVSGKPFTCKEIAKGFSPSVVFPHQQDCPTGKNPTSGDK
CGVALHSKSHHWGKCKKAFSHISTLVQDQRVLIREGLFECHKCGKACTRCNLIQHQKVHS
EVRPYSECGKCFTYYSSFVIHWRVHTGERPYSSECGKWFGQIYSLNSHQKVHIGERRYKC
RECGKFFQRSNLIQHQHAGERPYECRGCGKSFSQNFRLIYHQRIHTGERPHQCCECGKAF
SRNSSLIHHQRLHIQCSKCGKSFKQSSSFSSHWKVHMGKKPYACREGKSFSHSSNLKTHQ
RVHTEERPMECRECGKSFSCKSNLIKHLRIHTGERPYQCTDCGKCFSQSSSLIQHRQLDT
QKPYQRCDCGKGFACRSVLTQCRRVHTGVKH
Download sequence
Identical sequences ENSDORP00000001335 ENSDORP00000001335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]