SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001337 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001337
Domain Number 1 Region: 42-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.16e-21
Family SCAN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 331-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 285-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000117
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001337   Gene: ENSDORG00000001436   Transcript: ENSDORT00000001434
Sequence length 406
Comment pep:novel scaffold:dipOrd1:scaffold_5398:57061:59579:1 gene:ENSDORG00000001436 transcript:ENSDORT00000001434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLSLQSFQHEPSLDNLAFGNLEFNPTHGSTVKKEEVSVFSSSQLEFPQHSSNLGARQEL
QTLYQFFHSWLQPEKHSKEEIISQLVLEQFIISGYCKDKTDLKEKWESSGRSLEKLLEVL
TDDCVKTPDLVHVHMQGREALFSEHMPLREVIFHFRLAETLTGGTAGMFSGTASDPALGA
GNEAGYRNGKTTQADDSLTTGQGNHTAPLYIIQKENGSRTDEEVSCGDPRRASGSQEEFL
KRPNDQDGPSEGQLEFFSMSVRSSPELNPTHQSNDKHQGRSSQVQKVYKCKECSKTFAYL
SRFLAHQRRHRNERPFLCAECHKGFYQASDLVHQIIHTTKKPSVCSRCEKSFSHRTNLQA
HERIHTGEKPYTCSLCQRSYRQSSTYHHHLRIHQNIGPASVSPPKK
Download sequence
Identical sequences ENSDORP00000001337 ENSDORP00000001337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]