SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001352 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001352
Domain Number 1 Region: 31-122
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.19e-36
Family SCAN domain 0.0000523
Further Details:      
 
Domain Number 2 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 478-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 624-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-17
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 6 Region: 213-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000157
Family KRAB domain (Kruppel-associated box) 0.0063
Further Details:      
 
Domain Number 7 Region: 368-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000104
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001352   Gene: ENSDORG00000001453   Transcript: ENSDORT00000001449
Sequence length 678
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5089:47980:54018:1 gene:ENSDORG00000001453 transcript:ENSDORT00000001449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVAGQEGLLIVKLEEDCAWSQELPPPDPGPSPEASHLLFRRFRFQEAAGPREALSRLQ
ELCHGWLRPELRTKEQILELLVLEQFLTILPQEIKGRVQELHPESGEEAVTLVEDLQRKL
GRLRQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPESLEDMAVYISQEEWGHQDPRKKALSR
DTGQESYENMDSLEACIPNQEALSTQMEQDGKPWDPSIQGCKEGMSSRSPTPGEEKFEDP
DVSAQSVCPENTHSQALLPGQARGEMPWGRSLDRAEGHWDSPLEDRMEQSLVGATSCRGL
GQTKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMDVECGEIFGGHPHFLSLHR
GHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNVCGKSFSCNSNLHRHQRTHTG
EKPYKCLECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHERTHEKERLD
PFSECGEGMRNDSAPFLANHAPHRVEKKLFECLTCGKSFRQGMHLTRHQRTHTGEKPYKC
TLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCTECG
ENFSRSSRLMSHQRTHTG
Download sequence
Identical sequences ENSDORP00000001352 ENSDORP00000001352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]