SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001494 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001494
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily POZ domain 1.44e-29
Family BTB/POZ domain 0.00085
Further Details:      
 
Domain Number 2 Region: 459-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-19
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 504-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000097
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001494
Domain Number - Region: 417-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000322
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001494   Gene: ENSDORG00000001598   Transcript: ENSDORT00000001597
Sequence length 539
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3379:5821:21520:1 gene:ENSDORG00000001598 transcript:ENSDORT00000001597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVATHSCHLLQQLHEQRIQGLLCDCMLVVRGVCFKAHKNVLAAFSQYFRSLFQNSSSQ
KNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLNLCHTFLKSS
PVDQPPGLPCAGTFSLQGALTPDAACVMSEHFPPHLLQDCSAEAQPGKVLDGSHSHVPSD
RLHHSTGEMSKQAPEALDGSCAEPPCKQPNYYYKLRDLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEK
PFECNICGKHFSQXXXXXXXXXXXXXXXXXXXXXXXXXFAASGDVQRHIIIHSGEKPHLC
DTCGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRVRHTGERPYSCSAC
Download sequence
Identical sequences ENSDORP00000001494 ENSDORP00000001494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]