SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001514 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001514
Domain Number 1 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-21
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 107-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 247-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001514   Gene: ENSDORG00000001622   Transcript: ENSDORT00000001619
Sequence length 299
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_944:14296:15198:-1 gene:ENSDORG00000001622 transcript:ENSDORT00000001619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLSFIFTIELLLSWFVLDLETQKSSSENDLFEISLSQWKILGRIKNHGLQDHGLQNDR
DSKRQLTGQEALPEGYLSQVKMTSEKVSSNQKHTSAAPQQRIQFVEKPYECKECGKAFRV
RQQLTFHHRIHTGEKPYECKQCGMAFRQTAHLTRHQRLHSGEKLHECKECGEAFLYGPDL
RVHQKIHVGEKPYECKECGKAFRVRGQLTLHQRIHTGEKPYVCTECGKAFRQYAHLSRHQ
KLNTADRIYECKECGKDFLCGSGLRVHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIH
Download sequence
Identical sequences ENSDORP00000001514 ENSDORP00000001514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]