SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001638 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001638
Domain Number 1 Region: 518-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.65e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000354
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 3 Region: 212-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000785
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 478-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000119
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 184-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000145
Family Classic zinc finger, C2H2 0.053
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001638
Domain Number - Region: 691-752
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00788
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.022
Further Details:      
 
Domain Number - Region: 53-75
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0893
Family Classic zinc finger, C2H2 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001638   Gene: ENSDORG00000001751   Transcript: ENSDORT00000001751
Sequence length 774
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5077:73762:85158:1 gene:ENSDORG00000001751 transcript:ENSDORT00000001751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAMAVRVTAAHTAGARAEAGREAGEGGVAAAALAPGGFLGLPAPFSEEDEDDVHRCGR
CQVEFTALEDFVQHKIQKSCQRAPHEALPATPTATALLGQEVVPAAGPEEPITVAHIVVE
AASLAADISHAPDLVDSGHIKEVIVAAEAEPGDGEVPEAPPRRGPGLAEEAEQAQVKLLV
NKDGRYVCSLCHKTFKTGSILKAHMVTHSSRKDHQCALCGASFRTKGSLIRHHRRHTDER
PYKCAKCGKSFRESGALTRHLKSLTPCTEKLRFGTSKDVIVGKEDAPAGPGTSVGTVTSV
AGEPVETSPVIHLVTDAKGTVIHEVHVQMQELPLGVRALASEPPVPAERPCSVEGSRENL
LHQAMQNSGIVLERVAGEEGTLEAAPPSGSGPQPLGEGPPELPLLEAERMETQMAREASA
VPRTHPCPQCSESFPTAATLEAHKRGHQGPRPFTCAQCGKAFPKAYLLKKHQEVHMRERR
FRCGDCGKLYKTIAHVRGHRRVHSDERPFPCSQCGKRYKTKNAQQVHFRTHLEEKPHICQ
FCNRGFREKGSLVRHVRHHTGEKPFKCYRCGRGFAEHGTLNRHLRTKGGCLLEVEELLVS
EERSAAVLTEDPHAHAVLVEFSSVVADTQEYIIEATADDAETSEAAEIIEGAQTEVDSHI
MKVVQQIVHQASAGHQIIVQNVTVDQEAALAPEAAAAADTITIATPESLTEQVAMTLASA
IGEGTVLAARAGANGTEQATVTMVSSEDIEILEHGGELVIASPEGQLEVQTVIV
Download sequence
Identical sequences ENSDORP00000001638 ENSDORP00000001638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]