SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001665 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001665
Domain Number 1 Region: 177-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000835
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 2 Region: 761-782,928-955
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000323
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001665
Domain Number - Region: 593-614,655-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000729
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 1116-1141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0166
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001665   Gene: ENSDORG00000001773   Transcript: ENSDORT00000001778
Sequence length 1540
Comment pep:novel scaffold:dipOrd1:scaffold_15699:8622:27830:1 gene:ENSDORG00000001773 transcript:ENSDORT00000001778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAGEGDPSERRLEDSVIMRTLNPHHAQGSRRFLPHQGELKVWEKPPRGRPSFTWLQEMDD
QGAQRELGSRGDLSAFRRVTVPLGDLPKASGMDVAGRRGHPEDVEGLSRPSEWFLPASAS
EVATQTWTVNAEASVERLQPAPSPLPTGAYLGELLEEVAGTGASPDEEEDEEYEPAVFPC
VECNIYFRHKAHLLEHMNQHRQAPGHEPRAGPAPLACGECGWPFADPASLEQHRQRHQAS
REKIIEEIQKLKRCPGEGQGRPARWQRPACVFATNPSGAFAPPPGPPLEGAAGGHSRAGS
PIPEAGCAAAASDLSACLSCGFLAPSEGLLREHARLAHGGPQWEAFPEDLASQPGTSQGV
YARSPDVATVDYFGRAEPLLAPMWREENPAGCPDSQQLDIARNFPVSEPLLHHSGPGPLR
RLAFPTAPASTPYTIQLGGNKRTLERRGERRKRREEEEEEEEEEDIALTYEMDVAPEHGG
LPPPVARGLLPEPALRLKRTFQETLRSAQASRAQREQLRGMVPLVLLAKLGPQLMTAAAG
GSPRPQPEELALDLEATHPLDFLLLDAPIGSPLGLDRLLGGDPIGGLKPEDRKCPYCPDR
FHNGIGLANHVRGHLNRVGVSYNVRHFISAEEVKAIERRFSFQKKKKKVANFDPGTFSLM
RCDFCGAGFDTRAGLSSHARAHLRDFGITNWELTVSPINILQELLATSAAELPPSPLGRE
PPGPPGGFLTARRPRLHFTLPPPIWAEDPGPAYGDAQSLTTCEVCGACFETRKGLSSHAR
SHLRQLGVAESESSGAPIDLLYELVKQKGLPDAALGLPHGLAKKNNSPKDLLTGASRPGL
LSLAKPLDAPAINKAIKSPPGFSAKGLAHPPTSPLLKKAPLALPGSTAPKNPEDRSPQLS
LSPRPLSPKAQWPQSEDEGPLNLTSGPEPARDIRCEFCGEFFENRKGLSSHARSHLRQMG
ITEWYVNGSPIDTLREILKRRTQCRPGGHPHPPGPSPKALAKMVGSGGPGSSLDARSPSD
LHISPLAKKLPPPPGSPLGHSPTASPPTARKMFPGLAAPSLHKKLKPEQMRVEIKREMMP
GTLHGDPHPSEGPWGVPREDMAPLNLSSRAEPVRDIRCEFCGEFFENRKGLSSHARSHLR
QMGVTEWSVNGSPIDTLREILKKKSKLCLIKKEPPAGDLAPTLAEDGPLAAPGPLHSPLP
LSPLAGRPGKPGAGPAQIPRELSLTPITGAKPSAAGFLGAVAAKRPLQEDRLLPAEVKAK
TYIQTELPFKAKTLHEKASHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXHGRPFTKKFRSAGHGRDGEKRPPLGLAPGGLAFV
GRSAGAEPGLDAGRAADSGERPLAASPPGTVKSEDHQRQNINKIERRQARPPDASAARGG
EDAGDLQQKLEEVRQPPPRVRPVPSLVPRPPQTSLVKFVGNIYTLKCRFCEVEFQGPLSI
QEEWVRHLQRHILEMNFSKVDPPPEEPQAPQAQTAAAEAP
Download sequence
Identical sequences ENSDORP00000001665 ENSDORP00000001665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]