SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001677 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001677
Domain Number 1 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 516-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 459-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.38e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-18
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 391-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 10-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000144
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001677   Gene: ENSDORG00000001794   Transcript: ENSDORT00000001792
Sequence length 575
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_770:12653:17938:-1 gene:ENSDORG00000001794 transcript:ENSDORT00000001792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATSRDAAQVCGTFQDVVIYFSPEEWKFLNVAQRHLYLSVMLETFALRTSVGCGHKVG
GKEVCGHSGSVAGVAFSRTPATDASSLRARPCGVCASVLKDILCLAGLSVQKWSQGGACA
SLSTYQRLLGAEKPFKEDTDGTALSKSCESFVSEKYLTTCSSFWESFPSFSELQPLLTIL
NSEETSSCDSVEAPNYAENYYKLFVCSKAPIHKKMSIYNPRPCTENNLSEPTKSEPLCRK
DHSHAQPHRSHIRGKQYECKECGKSFKERRSLTAHQRNHTGERPYGCSQCGKSFKRKSTL
TVHLRDHTGERPYVCRECGKSFKRKTTLTVHHRSHTGERPYECRECGKSFKEKGVLTVHQ
RVHTGERPYVCNVCGKSFKKKSVHTVHLRNHTGERPYKCKDCGRCFKQKTGLNTHLRRYS
GEKPYECRECGKSFKEKSHLTFPKRERPYECRECGEIISSDLNVHLSSHNGERPYVCREC
GTSFKHRSSFSIHKRDHTGERPYECKDCGKSFKQEMLFIHERVHTEERPYECRECGKCFK
RNISLTVHQRIHSGERPHMCTVCGKAFKEKNYLTI
Download sequence
Identical sequences ENSDORP00000001677 ENSDORP00000001677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]