SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001691 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001691
Domain Number 1 Region: 152-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.18e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 208-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 95-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 46-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000021
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001691   Gene: ENSDORG00000001807   Transcript: ENSDORT00000001806
Sequence length 310
Comment pep:novel scaffold:dipOrd1:scaffold_193369:75:1007:-1 gene:ENSDORG00000001807 transcript:ENSDORT00000001806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLKGSPASFDCQCKDVCEPQPLLVSCSHQSTHTEGTSCSHEHYEDRLHRHETVQAAEKLC
KCDQDGKPCNQNAEPRHHQGDLKEKPYRCGQCGKSFTRSSSLLIHHAVHTDEKPYKCDKC
GKGFTRSSSLLIHHAVHTGEKPHKCDKCGKGFSQSSKLHIHQRVHTGEKPYECGECGMSF
SQRSNLHIHQRVHTGERPYKCRECGKGFSQSSNLHIHRCIHTGEKPYQCYECGKGFSQSS
DLRIHLRVHTGEKPYHCGRCGKGFSQSSKLLIHQRVHTGEKPYECGQCGKGFSQSSNLHI
HQRVHSKDPR
Download sequence
Identical sequences ENSDORP00000001691 ENSDORP00000001691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]