SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001693 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001693
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 1.26e-29
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000106
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 363-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000212
Family Classic zinc finger, C2H2 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001693   Gene: ENSDORG00000001810   Transcript: ENSDORT00000001808
Sequence length 467
Comment pep:novel scaffold:dipOrd1:scaffold_28720:11638:13041:-1 gene:ENSDORG00000001810 transcript:ENSDORT00000001808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCD
QVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCT
EVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGSHTDFPKAQELRDGENEEES
TKDELSSQITEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSIMAH
KRWIHVKPERLEQACEGMDVHAAYDEHQVTESINAMQTEHSVQPSGVEEDFHIGEKKVEA
EFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALTAGYSENIEMVTGIKEE
ASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN
Download sequence
Identical sequences A0A1S3FM44
ENSDORP00000001693 XP_012876945.1.60039 XP_012876946.1.60039 XP_012876947.1.60039 ENSDORP00000001693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]