SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001799 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001799
Domain Number 1 Region: 30-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000671
Family HkH motif-containing C2H2 finger 0.045
Further Details:      
 
Domain Number 2 Region: 276-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000164
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 3 Region: 192-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000908
Family HkH motif-containing C2H2 finger 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001799   Gene: ENSDORG00000001917   Transcript: ENSDORT00000001917
Sequence length 418
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4469:181707:190275:-1 gene:ENSDORG00000001917 transcript:ENSDORT00000001917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PASSSPSPLLASLPLPTRPLQPPLDFKHLLAFHFNGTTPLSLFPNFSTMDPVQKAVISHT
FGVPSPLKKKLFISCNICHLRFNSANQAEAHYKGHKHARKLKAVEAAKNKQRLQTLARDE
VVVSPVPSLASGAPGESQSKGPAACPLGPPLQLSLTPDPPATEPSHQDLLDATSSSTSSS
CPPRSPEPGREAPGPEPPAVAVGSGVGGEGRSEKGRLYCPTCKVTVNSASQLQAHNTGAK
HRWMMGGQGGAPRRGRGRTVSRGGPGHKTKRVTGGRAPRQGPTPPFHCALCQLQVNSETQ
LKQHMSSRRHKDRLAGKLPKPPSQHSKLQKHAALAVSVLKXXXXXXXXXXKTLAARFLPS
PLPTTAAAICALPGPLALRPAPTAAATLFPTPILGPALFRTPAGTVRPATGPILFAPY
Download sequence
Identical sequences ENSDORP00000001799 ENSDORP00000001799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]