SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001815 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001815
Domain Number 1 Region: 182-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.78e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 10-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 307-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 228-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000482
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001815   Gene: ENSDORG00000001936   Transcript: ENSDORT00000001934
Sequence length 367
Comment pep:novel scaffold:dipOrd1:scaffold_11277:9647:12856:1 gene:ENSDORG00000001936 transcript:ENSDORT00000001934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLLRERSKVPVSFEDVSVYFTKTEWKLLDLKQRILYKQVMLENYSHFVSLGLAFPKP
CLVAYLEQGEGAWVPALHREGAAESQAGDGVQKKTSVSKPRHCAQGGQSQEARSPDRSGS
LSPRSLLESLKNPALQRLKCAEKRYLCQQCGKSFSRSSNLIKHRIIHSGEKPYACRQCGK
LFRRSFALLEHQRIHSGEKPFACSECGKTFTRSSNLIKHQVIHSGEKPFACHECGKLFRR
SFALLEHARIHSGERPYACSVCAKAFSRSSNLIEHQRTHSGRKPYTCPECGKAFKGISQL
IHHQRSHSGERPFSCQECGKAFRGRSGLSQHRRVHSGEKPYECSECGKAFGRRANLFKHQ
AVHGTLR
Download sequence
Identical sequences ENSDORP00000001815 ENSDORP00000001815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]