SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001838 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001838
Domain Number 1 Region: 280-464
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.81e-52
Family Glutaminase 0.00033
Further Details:      
 
Domain Number 2 Region: 483-569
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.02e-19
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001838   Gene: ENSDORG00000001951   Transcript: ENSDORT00000001958
Sequence length 596
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5615:9036:29584:-1 gene:ENSDORG00000001951 transcript:ENSDORT00000001958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSMRALQSALSRARGHGRRGGWGHPSRSPLLGGGVRCHLSEAAARGRETPRSHQPQHQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMCQMHRMVQ
ESSSGGLLDRDLFQKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDCKELTGGKAP
AYTPHPSKSNPDLRGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMDCNKAEKFDFVLQYLNKMAG
NEFMGFSNATXXXXXXXXXXXXXXXXXXXEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSQRGISFCQKLVSLFNFHNYDNLRHCARKLDPRRNKT
VVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHTEVVKFLIEACKVNP
FAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAETLSKENLESMV
Download sequence
Identical sequences ENSDORP00000001838 ENSDORP00000001838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]