SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001861 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001861
Domain Number 1 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000449
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 196-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000128
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 3 Region: 173-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000162
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 4 Region: 312-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000184
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001861
Domain Number - Region: 16-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0636
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 128-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0662
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001861   Gene: ENSDORG00000001981   Transcript: ENSDORT00000001981
Sequence length 518
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5610:107851:116412:1 gene:ENSDORG00000001981 transcript:ENSDORT00000001981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPGKGPRKENLGLQCEWGSCSFVCSAMEEFFEHVTQHLQQHMHGSREEEGEEDDSDLL
EEEFSCLWQECGFCSMDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLSPCILDFQSRN
IIPDIPDHFLCLWEHCESSFDNPEWFYRHVEAHSLCCEYQAVGKDNHVVLCGWKDCTCTF
KDRCKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQRFQCSHCSKRFAT
ERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDYSCKNLIDLR
KHLDTHSKESAYRCDFENCDFSARSLSSIKSHFRKVHEGDSEPRYKCHVCDKCFTRGNNL
TVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEESDLEETLN
ESSLQGIILETVLGESGLKEETEEENGGVKGTAHSTSQDNPSPVIHMVNQTSAQGQREIV
YYVLSEAPGEPPPASEPPAESVLETLQGIPEEPELQTL
Download sequence
Identical sequences A0A1S3ELI3
XP_012865238.1.60039 ENSDORP00000001861 ENSDORP00000001861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]