SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001938 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001938
Domain Number 1 Region: 61-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.32e-58
Family Ankyrin repeat 0.0000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001938   Gene: ENSDORG00000002067   Transcript: ENSDORT00000002069
Sequence length 990
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_648:6891:156950:1 gene:ENSDORG00000002067 transcript:ENSDORT00000002069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPVERRGAGRPSQTRRGSPRVRFEDGA
VFLAACSSGDTDEVKKLLARGADINTVNVDGLTALHQACIDENLDMVRFLVENRANVNQQ
DNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQ
GVDLEQSRKEEEQQMLQDARQWLNSGKIEDVKQARSGATALHVAAAKGYSEVLRLLIQAG
YELNVQDHDGWTPLHAAAHWGVKEACSILAEALCNMDIRNKLGQTPFDVADEGLVEHLEM
LQKKQNVLRSEKETRNKLIESDLNSKLQSRLFKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXKKTEATVNHSSPENKSSVMEQIPSPTQNTFSASSARRFS
SSLFSKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSRDALRDRGLSIYRSSSSPRISAL
LDNKDERENKGYFSSLVPRRLSSTSDIEEKENRESAVNLVRSGSYTRQLWRDEGKGNETQ
QKIAPSNYVSTYLKRTPYRSQADSTAEKAADSISSGTPLCVITNRPPPNTTNGVTAASVP
SSPGTDSSVEGREKRRSYLTPVRDEEAESLRKARSRQARQTRRSTQGVTLTDLQEAERTF
SRSRAERQAQEQPGEKPVDTEAPEKSTEKQDPSIAPAKEAEEGQQPWEEPVYHHMRYPSQ
LDKPTTPVSPSTSRPSFYTSSHHKLQTSKSSAPDSESSETTTNTTTAKEMDKSESKEADL
DDQSSDRLSIRERRRRRRGTGINFWTKDEDEGDVSEEVKETWAERFKRLESGGSNPTTSD
SYADRASARARREAREARLASLTSRVEEDSNRDYKRLYENALTENQKLKTKLQEAQLELS
DIKSKLEKMAQQKQEKTSDRSSMLEMEKRERRALERKMSEMEEEMKNLHQLKQIQTLKQM
NEQLQAENRALTRVVARLSESIESSDTQEL
Download sequence
Identical sequences ENSDORP00000001938 ENSDORP00000001938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]