SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002009 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002009
Domain Number 1 Region: 456-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.51e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 705-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 747-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 397-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 495-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 342-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000399
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002009   Gene: ENSDORG00000002144   Transcript: ENSDORT00000002144
Sequence length 839
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6271:129:403497:1 gene:ENSDORG00000002144 transcript:ENSDORT00000002144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQVSCGSTRPALPVSLGPGPPYAVLGVRCHTPRVQVISSELSTTKHKMNKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCVPKPNLIVKLEQAVEPRIK
EASSKNFTNLWNADHLKDRSQENPSKHLWEVVFINNKRLTQEKGHIIGKPFNLDINSFSP
TKVFCHCDSYGMSFNRISELIFSRTTYLRNEPDEFNACGKLLLKIKHEETHCKERSEVLK
NRTSSSHHEAPIQHEKIQTLHIFEYNVSEAFLEKTLFNPHTNENRDEIDHASSEHGRTPS
NASSLLYPEVVSSEENPWKSIPLKHGSIHKTHCEYSKSGTHFKSKLCLSQPQTTHKGEKH
FKCPDCGKGFLEKSCLTRHHRVHTGEKHFGYKECGKTFWEKSNLMKHQQSHVGEKTYECN
QCSKAFSHKSALILHQRMHTGEKPNRCTACVKMSYQKSDLSKHQRTHTGLKPYECNEYGK
SFCMNSHLTVHQRTHTGEKPFACLECGKSFCQKSHLTQPQRTHIGDKPYTCDICGKAFYH
KSVLRRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCNECEKSFCVKSGLILHQRKHT
GEKPYECIECGKSFSHKSSLTVHHRTHTGEKSCQCNECGKIFYRKSDLVKHQRSHTGEKP
YECNTCRKTFSQKSNLSVHQRIHTRSLMSEMDIRHEPQISPLSHHAHTGESSAASSNIY
Download sequence
Identical sequences ENSDORP00000002009 ENSDORP00000002009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]