SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002065 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002065
Domain Number 1 Region: 53-174
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000419
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002065   Gene: ENSDORG00000002200   Transcript: ENSDORT00000002201
Sequence length 322
Comment pep:novel scaffold:dipOrd1:scaffold_19900:7612:20637:-1 gene:ENSDORG00000002200 transcript:ENSDORT00000002201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPNFKLQGHFILIFLAALRGESRYLEMQEAVGYDPLLLFNANLKRDLAGEQPYRRALRC
LDMLSLPGQFTFTADQPQLHCAAFFIGEPQEFITIHYDLVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPTMERYIDFCESGLIRRSIRSSQNVAMIFFRVHEPGNGFTLTIKMDSNL
FPCNVISQTPNGRFTLVVPHQHRNCSFSIIYPVAIKISDLTLGHFHGLHLKRPPADCGEI
GDFVELLGGTGLDPSKMMPLADLCYPFHGPAQMKIGCDNTVVRMVSSGKHINRVTFEYRQ
LEPSELENENGNSIPEFCLLSL
Download sequence
Identical sequences A0A1S3FVW3
XP_012880698.1.60039 ENSDORP00000002065 ENSDORP00000002065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]