SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002163 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002163
Domain Number 1 Region: 55-112
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 111-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 3-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-20
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 168-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-20
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 7 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-19
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 392-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-18
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002163   Gene: ENSDORG00000002302   Transcript: ENSDORT00000002302
Sequence length 499
Comment pep:novel scaffold:dipOrd1:scaffold_17273:5656:7740:1 gene:ENSDORG00000002302 transcript:ENSDORT00000002302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSSLINHKSTHSGEKNCKCDECGKSFNYSSVLDQHKRIHTGEKPYECGECGKAFRNSS
GLRVHKRIHTGEKPYECDTCGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFITCRTLLN
HKSIHFGDKPYKCDECGKAFRNNSGLKVHKRIHTGERPYKCEECGKAYISLSSLINHKSV
HPGEKPFKCDECEKAFATHRTLLNHKKIHLGEKPYKCDVCEKSFNYTSLLSQHKRVHTRE
KPYECDRCEKVFRNNSSLKVHKRIHTGEKPYECDVCGKAYISHSSLINHKSTHPGKTPYT
CDECGKAFFSSRTLISHKRVHLGEKPFKCVECGKSFSYSSLLSQHKRIHTGEKPFVCDWC
GKAFRNSSGLTVHKRIHTGEKPYGCDECGKAYISHSSLINHKSVHCGNQPYNCECGKSFN
YRSVLDQHKRIHTGKKPYRCNECGKAFNIRSNLTKHKRIHMGEESSNMVHMGSYSGPSQK
RIYEGGNALEGTRMRIPLW
Download sequence
Identical sequences ENSDORP00000002163 ENSDORP00000002163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]