SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002177 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002177
Domain Number 1 Region: 16-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 224-341
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 425-462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 137-174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000995
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 183-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 386-423
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002177
Domain Number - Region: 347-384
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00101
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002177   Gene: ENSDORG00000002320   Transcript: ENSDORT00000002319
Sequence length 745
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2678:789:10794:1 gene:ENSDORG00000002320 transcript:ENSDORT00000002319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFFLTGRLSSAVPAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITIS
FRNFDVEESHQCSLDWLLLGPAASPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSG
QAQGFRLSYIRGKLGQVACQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEP
PGSLCPGGTFPCSGARSTRCLPAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFAS
PDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSY
RSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGGSSVGDGSGDQ
GCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADE
KNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCG
LLLVIALGCAFKLYSLRTQEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRLWNRLFHRPRAPRGQIPLLTAAR
TSQTVLGDGFLQPASGVAPDPPAPQTDTGSPQVAGGGPSIGPGHTAEVGSSGPSSLSGLQ
DSERTPADKDIKTPRESVTDSPGPGDTSPEPCLARDPQPQAPTTTSSSSSSSSTHSPESL
GVCRSPPPPCSPTSEASDDDALLVC
Download sequence
Identical sequences ENSDORP00000002177 ENSDORP00000002177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]