SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002204 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002204
Domain Number 1 Region: 95-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 40-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 197-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-19
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 2-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000292
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002204   Gene: ENSDORG00000002347   Transcript: ENSDORT00000002346
Sequence length 261
Comment pep:novel scaffold:dipOrd1:scaffold_20268:6369:7151:-1 gene:ENSDORG00000002347 transcript:ENSDORT00000002346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYKCPMCREFFSERADLFMHQKSHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYK
CDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSEC
GRGFSNSSNLCMHQRVHTGEKPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAF
SQSSSLCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRVHTGEKPFKCDECGKAFSQST
SLCIHQRVHTKERNHLKIAVM
Download sequence
Identical sequences A0A1S3FQH2
ENSDORP00000002204 XP_012878609.1.60039 XP_012878610.1.60039 XP_012878612.1.60039 ENSDORP00000002204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]