SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002417 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002417
Domain Number 1 Region: 542-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000536
Family C2HC finger 0.018
Further Details:      
 
Domain Number 2 Region: 681-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000106
Family C2HC finger 0.015
Further Details:      
 
Domain Number 3 Region: 1110-1141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000015
Family C2HC finger 0.011
Further Details:      
 
Domain Number 4 Region: 244-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000838
Family C2HC finger 0.024
Further Details:      
 
Domain Number 5 Region: 335-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000715
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002417
Domain Number - Region: 296-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00262
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002417   Gene: ENSDORG00000002573   Transcript: ENSDORT00000002573
Sequence length 1147
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5220:68888:371351:1 gene:ENSDORG00000002573 transcript:ENSDORT00000002573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRRLSSGREICRPLEDAIEDEEEECPSEETDIISKGDFPLEESFPTEFGPENLSCEEVE
YFCNKGDDEGIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQLP
VGTTWGPFAGKMDLNNNSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQL
WCTTTKAISEGEELIAFVVDFDSRLQAASQMTLTEGMYPARLLDSIQLLPQQAAMASILP
TAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEETEDSTHQISSLCPFP
QCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINFHQHLFSHLTQA
AFRCNHCHFGFQTQRELVQHQELHAPGGKLPRESDMEHSPSGTEDSLQPATDLLARSELS
QSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLAS
SPVQPSMGPSFPVGPFLSQFAFPQDITMVPQASEILAKMSELVHRRLRHGSSNYPPVIYS
PLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVSEKISEAVSPNTGQ
TSINLLNPAAHSADPDNPLLQTPCLNSSAVLDLIGPNGKGHDKDFSTQAKKLSTSNSNDD
KINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHETYMVHKQYYCATRHDPPLKRS
ASSKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLAQQRFLDVANLSNPCTSTQEPPEGLG
DCYHPRCDIFPGIVSKHLETSLTMNKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQSE
RTTASPKLLDYHECTVCKISFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXPSDYISGSVIHNSDLEQSTNAENESKGQASSNGC
AVPKKDSLPLLPKNRGMVIVNGGLKQDERSAVNPQQENISQNPQHEDGHKSPSWISENPL
APNENVSPGIPSAEEQLSSIAKGVNGSTQAPTSGKYCRLCDIQFNNLSNFITHKKFYCSS
HAAEHVK
Download sequence
Identical sequences ENSDORP00000002417 ENSDORP00000002417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]